PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN06991.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family TALE
Protein Properties Length: 573aa    MW: 64247.3 Da    PI: 7.2759
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN06991.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-093754121954
                 HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
    Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                 Fe   ++yp+ +++  LAk++gL+ +qV++WF N R +
  KHN06991.1 375 FEHflHPYPTDTDKLMLAKQTGLSRNQVSNWFINARVR 412
                 554459******************************88 PP

2BELL97.21.4e-31248314672
        BELL   6 qkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                 ++kk +Ll++l+eV++rY+qy++q+++vi sFe vaglg+ +pY+slA +a+S+ FrcLk+ai++q+
  KHN06991.1 248 RMKKCRLLTMLDEVHRRYRQYYQQMHAVITSFEYVAGLGNVAPYASLAINAMSKPFRCLKNAITDQL 314
                 69**************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005745.3E-43177312IPR006563POX domain
PfamPF075264.4E-36182311IPR006563POX domain
PROSITE profilePS5007112.131353416IPR001356Homeobox domain
SMARTSM003893.3E-10356420IPR001356Homeobox domain
CDDcd000861.20E-12356417No hitNo description
SuperFamilySSF466895.13E-17358423IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.609.0E-28359420IPR009057Homeodomain-like
PfamPF059201.4E-18373412IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 573 aa     Download sequence    Send to blast
MAEEGFEHYH VPQQSRRNKL RVFPEHQPYC FVESSSTCPT LASLYDPSLI IPSDLLACAT  60
QQGGGGAAAK EQEGSNLMMG FVKGAVVNGD AIQVIINNNN PLYQLQNLRE YGDTYNDGSE  120
MMVFKPEPLS LSLSSHSNST HHYPLELNLQ QYGAVNPGLV GGNSEVSRNS VPLGPFTGYA  180
SILKGSRFLK PAQQLLEELC DVGVRGIYTT EKIIAPDASL MEPPREGFSA SEVVGGDDPL  240
GEYQNYGRMK KCRLLTMLDE VHRRYRQYYQ QMHAVITSFE YVAGLGNVAP YASLAINAMS  300
KPFRCLKNAI TDQLQFINKA PFQISNRKDE SPRFHSSDRG THSQRPGFLE HQQPVWRPQR  360
GLPERAVSVL RAWLFEHFLH PYPTDTDKLM LAKQTGLSRN QVSNWFINAR VRLWKPMVEE  420
IHMLESQQGQ KRSHWEERSK KNLSDHLPSD HNSVVTENPS TSMEKFHDAP YKHPRNELAN  480
KQVRSQEQLN QTNTGNQQVM GVGVSNNGVS LTLGLHQNHH GIGLFEPFGM SAAQRFGVAL  540
QPEGYVLSSF ESQNRHFGRD VIGGGQLLHD FAC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A8e-16362420563Homeobox protein Meis2
3k2a_B8e-16362420563Homeobox protein Meis2
4xrs_A8e-16362419158Homeobox protein Meis1
4xrs_B8e-16362419158Homeobox protein Meis1
5bng_A8e-16362420159Homeobox protein Meis2
5bng_B8e-16362420159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150371e-168AP015037.1 Vigna angularis var. angularis DNA, chromosome 4, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003551512.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A0B2PCG20.0A0A0B2PCG2_GLYSO; BEL1-like homeodomain protein 9
STRINGGLYMA18G41280.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28103373
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.11e-113TALE family protein
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]